Brand | Abnova |
Product type | Primary antibodies |
Reactivity | Human |
Host species | Rabbit |
Applications | WB,IHC-P,IF |
Brand: | Abnova |
Reference: | PAB29483 |
Product name: | CAND1 polyclonal antibody |
Product description: | CAND1 polyclonal antibody raised against recombinant human CAND1. |
Isotype: | IgG |
Gene id: | 55832 |
Gene name: | CAND1 |
Gene alias: | DKFZp434M1414|FLJ10114|FLJ10929|FLJ38691|FLJ90441|KIAA0829|TIP120|TIP120A |
Gene description: | cullin-associated and neddylation-dissociated 1 |
Immunogen: | Recombinant protein corresponding to amino acids of human CAND1. |
Immunogen sequence/protein sequence: | QTRPVQSWLCDPDAMEQGETPLTMLQSQVPNIVKALHKQMKEKSVKTRQCCFNMLTELVNVLPG |
Protein accession: | Q86VP6 |
Form: | Liquid |
Recommend dilutions: | Immunofluorescence (1-4 ug/mL) Immunohistochemistry (1:1000-1:2500) Western Blot (1:100-1:250) The optimal working dilution should be determined by the end user. |
Storage buffer: | In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide) |
Storage instruction: | Store at 4°C. For long term storage store at -20°C. Aliquot to avoid repeated freezing and thawing. |
Note: | This product contains sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only. |
Product type: | Primary antibodies |
Host species: | Rabbit |
Antigen species / target species: | Human |
Reactivity: | Human |
Application image: | ![]() |
Application image note: | Immunohistochemical staining (Formalin-fixed paraffin-embedded sections) of human kidney with CAND1 polyclonal antibody (Cat# PAB29483) shows moderate cytoplasmic and nuclear positivity in renal tubules at 1:1000 - 1:2500 dilution. |
Applications: | WB,IHC-P,IF |
Shipping condition: | Dry Ice |