ELF4 polyclonal antibody View larger

ELF4 polyclonal antibody

New product

455,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of ELF4 polyclonal antibody

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesRabbit
ApplicationsIHC-P,IF

More info about ELF4 polyclonal antibody

Brand: Abnova
Reference: PAB29473
Product name: ELF4 polyclonal antibody
Product description: Rabbit polyclonal antibody raised against recombinant human ELF4.
Isotype: IgG
Gene id: 2000
Gene name: ELF4
Gene alias: ELFR|MEF
Gene description: E74-like factor 4 (ets domain transcription factor)
Immunogen: Recombinant protein corresponding to human ELF4.
Immunogen sequence/protein sequence: SSRVSSRSAPQGKGSSSWEKPKIQHVGLQPSASLELGPSLDEEIPTTSTMLVSPAEGQVKLTKAVSASSVPSNIHLGVA
Form: Liquid
Recommend dilutions: Immunohistochemistry (1:500-1:1000)
Immunofluorescence (1-4 ug/mL)
The optimal working dilution should be determined by the end user.
Storage buffer: In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Storage instruction: Store at 4°C. For long term storage store at -20°C.
Aliquot to avoid repeated freezing and thawing.
Note: This product contains sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
Product type: Primary antibodies
Host species: Rabbit
Antigen species / target species: Human
Reactivity: Human
Application image: PAB29473-48-7-1.jpg
Application image note: Immunohistochemical staining of human colon with ELF4 polyclonal antibody (Cat # PAB29473) shows moderate nuclear positivity in glandular cells.
Applications: IHC-P,IF
Shipping condition: Dry Ice

Reviews

Buy ELF4 polyclonal antibody now

Add to cart