PKN3 polyclonal antibody View larger

PKN3 polyclonal antibody

New product

455,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of PKN3 polyclonal antibody

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesRabbit
ApplicationsIHC-P,IF

More info about PKN3 polyclonal antibody

Brand: Abnova
Reference: PAB29472
Product name: PKN3 polyclonal antibody
Product description: Rabbit polyclonal antibody raised against recombinant human PKN3.
Isotype: IgG
Gene id: 29941
Gene name: PKN3
Gene alias: RP11-545E17.1
Gene description: protein kinase N3
Immunogen: Recombinant protein corresponding to human PKN3.
Immunogen sequence/protein sequence: DCIVNMDAPYPGFLSVQGLEFIQKLLQKCPEKRLGAGEQDAEEIKVQPFFRTTNWQALLARTIQ
Form: Liquid
Recommend dilutions: Immunohistochemistry (1:50-1:200)
Immunofluorescence (1-4 ug/mL)
The optimal working dilution should be determined by the end user.
Storage buffer: In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Storage instruction: Store at 4°C. For long term storage store at -20°C.
Aliquot to avoid repeated freezing and thawing.
Note: This product contains sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
Product type: Primary antibodies
Host species: Rabbit
Antigen species / target species: Human
Reactivity: Human
Application image: PAB29472-48-302-1.jpg
Application image note: Immunohistochemical staining of human nasopharynx with PKN3 polyclonal antibody (Cat #P AB29472) shows moderate cytoplasmic positivity in respiratory epithelial cells.
Applications: IHC-P,IF
Shipping condition: Dry Ice

Reviews

Buy PKN3 polyclonal antibody now

Add to cart