Brand | Abnova |
Product type | Primary antibodies |
Reactivity | Human |
Host species | Rabbit |
Applications | WB-Ce,IHC-P,IF |
Brand: | Abnova |
Reference: | PAB29467 |
Product name: | RBL1 polyclonal antibody |
Product description: | Rabbit polyclonal antibody raised against recombinant human RBL1. |
Isotype: | IgG |
Gene id: | 5933 |
Gene name: | RBL1 |
Gene alias: | CP107|MGC40006|PRB1|p107 |
Gene description: | retinoblastoma-like 1 (p107) |
Immunogen: | Recombinant protein corresponding to human RBL1. |
Immunogen sequence/protein sequence: | DAEEEIGTPRKFTRDTPLGKLTAQANVEYNLQQHFEKKRSFAPSTPLTGRRYLRE |
Form: | Liquid |
Recommend dilutions: | Immunohistochemistry (1:500-1:1000) Immunofluorescence (1-4 ug/mL) Western Blot (1:250-1:500) The optimal working dilution should be determined by the end user. |
Storage buffer: | In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide) |
Storage instruction: | Store at 4°C. For long term storage store at -20°C. Aliquot to avoid repeated freezing and thawing. |
Note: | This product contains sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only. |
Product type: | Primary antibodies |
Host species: | Rabbit |
Antigen species / target species: | Human |
Reactivity: | Human |
Application image: | ![]() |
Application image note: | Immunohistochemical staining of human colon with RBL1 polyclonal antibody (Cat # PAB29467) shows moderate nuclear positivity in glandular cells at 1:500-1:1000 dilution. |
Applications: | WB-Ce,IHC-P,IF |
Shipping condition: | Dry Ice |