ATF1 polyclonal antibody View larger

ATF1 polyclonal antibody

New product

455,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of ATF1 polyclonal antibody

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesRabbit
ApplicationsIHC-P,IF

More info about ATF1 polyclonal antibody

Brand: Abnova
Reference: PAB29461
Product name: ATF1 polyclonal antibody
Product description: Rabbit polyclonal antibody raised against recombinant human ATF1.
Isotype: IgG
Gene id: 466
Gene name: ATF1
Gene alias: EWS-ATF1|FUS/ATF-1|TREB36
Gene description: activating transcription factor 1
Immunogen: Recombinant protein corresponding to human ATF1.
Immunogen sequence/protein sequence: MEDSHKSTTSETAPQPGSAVQGAHISHIAQQVSSLSESEESQDSSDSIGSSQKAHGILARRPSY
Form: Liquid
Recommend dilutions: Immunohistochemistry (1:200-1:500)
Immunofluorescence (1-4 ug/mL)
The optimal working dilution should be determined by the end user.
Storage buffer: In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Storage instruction: Store at 4°C. For long term storage store at -20°C.
Aliquot to avoid repeated freezing and thawing.
Note: This product contains sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
Product type: Primary antibodies
Host species: Rabbit
Antigen species / target species: Human
Reactivity: Human
Application image: PAB29461-48-2-1.jpg
Application image note: Immunohistochemical staining of human kidney with ATF1 polyclonal antibody (Cat # PAB29461) shows moderate nuclear positivity in renal tubules and cells in glomeruli.
Applications: IHC-P,IF
Shipping condition: Dry Ice

Reviews

Buy ATF1 polyclonal antibody now

Add to cart