RBL1 polyclonal antibody View larger

RBL1 polyclonal antibody

New product

455,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of RBL1 polyclonal antibody

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesRabbit
ApplicationsWB-Ce,IHC-P,IF

More info about RBL1 polyclonal antibody

Brand: Abnova
Reference: PAB29459
Product name: RBL1 polyclonal antibody
Product description: Rabbit polyclonal antibody raised against recombinant human RBL1.
Isotype: IgG
Gene id: 5933
Gene name: RBL1
Gene alias: CP107|MGC40006|PRB1|p107
Gene description: retinoblastoma-like 1 (p107)
Immunogen: Recombinant protein corresponding to human RBL1.
Immunogen sequence/protein sequence: ESLAWSHDSALWEALQVSANKVPTCEEVIFPNNFETGNGGNVQGHLPLMPMSPLMHPRVKEVRTDSGSLRRDMQPLSPISVHER
Form: Liquid
Recommend dilutions: Immunohistochemistry (1:500-1:1000)
Immunofluorescence (1-4 ug/mL)
Western Blot (1:500-1:1000)
The optimal working dilution should be determined by the end user.
Storage buffer: In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Storage instruction: Store at 4°C. For long term storage store at -20°C.
Aliquot to avoid repeated freezing and thawing.
Note: This product contains sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
Product type: Primary antibodies
Host species: Rabbit
Antigen species / target species: Human
Reactivity: Human
Application image: PAB29459-48-7-1.jpg
Application image note: Immunohistochemical staining of human colon with RBL1 polyclonal antibody (Cat # PAB29459) shows strong nuclear and cytoplasmic positivity in glandular cells at 1:500-1:1000 dilution.
Applications: WB-Ce,IHC-P,IF
Shipping condition: Dry Ice

Reviews

Buy RBL1 polyclonal antibody now

Add to cart