BAT3 polyclonal antibody View larger

BAT3 polyclonal antibody

New product

455,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of BAT3 polyclonal antibody

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesRabbit
ApplicationsWB-Ce,IHC-P,IF

More info about BAT3 polyclonal antibody

Brand: Abnova
Reference: PAB29451
Product name: BAT3 polyclonal antibody
Product description: Rabbit polyclonal antibody raised against recombinant human BAT3.
Isotype: IgG
Gene id: 7917
Gene name: BAT3
Gene alias: BAG-6|BAG6|D6S52E|G3
Gene description: HLA-B associated transcript 3
Immunogen: Recombinant protein corresponding to human BAT3.
Immunogen sequence/protein sequence: SDAYLSGMPAKRRKTMQGEGPQLLLSEAVSRAAKAAGARPLTSPESLSRDLEAPEVQESYRQQLRSDIQKRLQEDPNYS
Form: Liquid
Recommend dilutions: Immunohistochemistry (1:200-1:500)
Immunofluorescence (1-4 ug/mL)
Western Blot (1:250-1:500)
The optimal working dilution should be determined by the end user.
Storage buffer: In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Storage instruction: Store at 4°C. For long term storage store at -20°C.
Aliquot to avoid repeated freezing and thawing.
Note: This product contains sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
Product type: Primary antibodies
Host species: Rabbit
Antigen species / target species: Human
Reactivity: Human
Application image: PAB29451-48-12-1.jpg
Application image note: Immunohistochemical staining of human testis with BAT3 polyclonal antibody (Cat # PAB29451) shows strong cytoplasmic and nuclear positivity in cells in seminiferus ducts at 1:200-1:500 dilution.
Applications: WB-Ce,IHC-P,IF
Shipping condition: Dry Ice

Reviews

Buy BAT3 polyclonal antibody now

Add to cart