NFIC polyclonal antibody View larger

NFIC polyclonal antibody

New product

455,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of NFIC polyclonal antibody

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesRabbit
ApplicationsIHC-P,IF

More info about NFIC polyclonal antibody

Brand: Abnova
Reference: PAB29447
Product name: NFIC polyclonal antibody
Product description: Rabbit polyclonal antibody raised against recombinant human NFIC.
Isotype: IgG
Gene id: 4782
Gene name: NFIC
Gene alias: CTF|CTF5|MGC20153|NF-I|NFI
Gene description: nuclear factor I/C (CCAAT-binding transcription factor)
Immunogen: Recombinant protein corresponding to human NFIC.
Immunogen sequence/protein sequence: RTLPSTSSSGSKRHKSGSMEEDVDTSPGGDYYTSPSSPTSSSRNWTEDMEGGISSPVKKTEMDKSPFNSPS
Form: Liquid
Recommend dilutions: Immunohistochemistry (1:200-1:500)
Immunofluorescence (1-4 ug/mL)
The optimal working dilution should be determined by the end user.
Storage buffer: In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Storage instruction: Store at 4°C. For long term storage store at -20°C.
Aliquot to avoid repeated freezing and thawing.
Note: This product contains sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
Product type: Primary antibodies
Host species: Rabbit
Antigen species / target species: Human
Reactivity: Human
Application image: PAB29447-48-4-1.jpg
Application image note: Immunohistochemical staining of human stomach with NFIC polyclonal antibody (Cat # PAB29447) shows strong nuclear positivity in glandular cells.
Applications: IHC-P,IF
Shipping condition: Dry Ice

Reviews

Buy NFIC polyclonal antibody now

Add to cart