PLK1 polyclonal antibody View larger

PLK1 polyclonal antibody

New product

455,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of PLK1 polyclonal antibody

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesRabbit
ApplicationsIHC-P,IF

More info about PLK1 polyclonal antibody

Brand: Abnova
Reference: PAB29442
Product name: PLK1 polyclonal antibody
Product description: Rabbit polyclonal antibody raised against recombinant human PLK1.
Isotype: IgG
Gene id: 5347
Gene name: PLK1
Gene alias: PLK|STPK13
Gene description: polo-like kinase 1 (Drosophila)
Immunogen: Recombinant protein corresponding to human PLK1.
Immunogen sequence/protein sequence: RPTINELLNDEFFTSGYIPARLPITCLTIPPRFSIAPSSLDPSNRKPLTVLNKGLENPLPERPREKEEPVVRETGEVVDCHLSDMLQQLHSVNA
Form: Liquid
Recommend dilutions: Immunohistochemistry (1:20-1:50)
Immunofluorescence (1-4 ug/mL)
The optimal working dilution should be determined by the end user.
Storage buffer: In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Storage instruction: Store at 4°C. For long term storage store at -20°C.
Aliquot to avoid repeated freezing and thawing.
Note: This product contains sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
Product type: Primary antibodies
Host species: Rabbit
Antigen species / target species: Human
Reactivity: Human
Application image: PAB29442-48-7-1.jpg
Application image note: Immunohistochemical staining of human colon with PLK1 polyclonal antibody (Cat # PAB29442) shows moderate cytoplasmic and nuclear positivity in glandular cells.
Applications: IHC-P,IF
Shipping condition: Dry Ice

Reviews

Buy PLK1 polyclonal antibody now

Add to cart