EID1 polyclonal antibody View larger

EID1 polyclonal antibody

New product

455,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of EID1 polyclonal antibody

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesRabbit
ApplicationsIHC-P,IF

More info about EID1 polyclonal antibody

Brand: Abnova
Reference: PAB29435
Product name: EID1 polyclonal antibody
Product description: Rabbit polyclonal antibody raised against recombinant human EID1.
Isotype: IgG
Gene id: 23741
Gene name: EID1
Gene alias: C15orf3|CRI1|EID-1|IRO45620|MGC138883|MGC138884|PNAS-22|PTD014|RBP21
Gene description: EP300 interacting inhibitor of differentiation 1
Immunogen: Recombinant protein corresponding to human EID1.
Immunogen sequence/protein sequence: MSEMAELSELYEESSDLQMDVMPGEGDLPQMEVGSGSRELSLRPSRSGAQQLEEEGPMEEEEAQPMAAPEGKRSLANGPNAGEQPGQVAGADFESED
Form: Liquid
Recommend dilutions: Immunohistochemistry (1:200-1:500)
Immunofluorescence (1-4 ug/mL)
The optimal working dilution should be determined by the end user.
Storage buffer: In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Storage instruction: Store at 4°C. For long term storage store at -20°C.
Aliquot to avoid repeated freezing and thawing.
Note: This product contains sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
Product type: Primary antibodies
Host species: Rabbit
Antigen species / target species: Human
Reactivity: Human
Application image: PAB29435-48-12-1.jpg
Application image note: Immunohistochemical staining of human testis with EID1 polyclonal antibody (Cat # PAB29435) shows strong cytoplasmic and nuclear positivity in cells in seminiferus ducts and Leydig cells.
Applications: IHC-P,IF
Shipping condition: Dry Ice

Reviews

Buy EID1 polyclonal antibody now

Add to cart