PEG10 polyclonal antibody View larger

PEG10 polyclonal antibody

New product

455,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of PEG10 polyclonal antibody

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesRabbit
ApplicationsIHC-P,IF

More info about PEG10 polyclonal antibody

Brand: Abnova
Reference: PAB29434
Product name: PEG10 polyclonal antibody
Product description: Rabbit polyclonal antibody raised against recombinant human PEG10.
Isotype: IgG
Gene id: 23089
Gene name: PEG10
Gene alias: Edr|HB-1|KIAA1051|MEF3L|Mar2|Mart2|RGAG3
Gene description: paternally expressed 10
Immunogen: Recombinant protein corresponding to human PEG10.
Immunogen sequence/protein sequence: QCIHIERRLARAAAARKPRSPPRALVLPHIASHHQVDPTEPVGGARMRLTQEEKERRRKLNLCLYCGTGGHYADNCPAKASKSS
Form: Liquid
Recommend dilutions: Immunohistochemistry (1:500-1:1000)
Immunofluorescence (1-4 ug/mL)
The optimal working dilution should be determined by the end user.
Storage buffer: In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Storage instruction: Store at 4°C. For long term storage store at -20°C.
Aliquot to avoid repeated freezing and thawing.
Note: This product contains sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
Product type: Primary antibodies
Host species: Rabbit
Antigen species / target species: Human
Reactivity: Human
Application image: PAB29434-48-41-1.jpg
Application image note: Immunohistochemical staining of human placenta with PEG10 polyclonal antibody (Cat # PAB29434) shows strong cytoplasmic positivity in a subset of trophoblastic cells.
Applications: IHC-P,IF
Shipping condition: Dry Ice

Reviews

Buy PEG10 polyclonal antibody now

Add to cart