CTNNB1 polyclonal antibody View larger

CTNNB1 polyclonal antibody

New product

455,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of CTNNB1 polyclonal antibody

BrandAbnova
Product typePrimary antibodies
ReactivityHuman,Mouse,Rat
Host speciesRabbit
ApplicationsWB-Ce,IHC-P

More info about CTNNB1 polyclonal antibody

Brand: Abnova
Reference: PAB29422
Product name: CTNNB1 polyclonal antibody
Product description: Rabbit polyclonal antibody raised against recombinant human CTNNB1.
Isotype: IgG
Gene id: 1499
Gene name: CTNNB1
Gene alias: CTNNB|DKFZp686D02253|FLJ25606|FLJ37923
Gene description: catenin (cadherin-associated protein), beta 1, 88kDa
Immunogen: Recombinant protein corresponding to human CTNNB1.
Immunogen sequence/protein sequence: SYLDSGIHSGATTTAPSLSGKGNPEEEDVDTSQVLYEWEQGFSQSFTQEQVADIDGQYAMTRAQRVRAAMFPETLDEGMQIPSTQFDAAH
Form: Liquid
Recommend dilutions: Immunohistochemistry (1:500-1:1000)
Immunofluorescence (1-4 ug/mL)
Western Blot (1:500-1:1000)
The optimal working dilution should be determined by the end user.
Storage buffer: In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Storage instruction: Store at 4°C. For long term storage store at -20°C.
Aliquot to avoid repeated freezing and thawing.
Note: This product contains sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
Product type: Primary antibodies
Host species: Rabbit
Antigen species / target species: Human
Reactivity: Human,Mouse,Rat
Application image: PAB29422-48-4-1.jpg
Application image note: Immunohistochemical staining of human stomach with CTNNB1 polyclonal antibody (Cat # PAB29422) shows strong membranous and cytoplasmic positivity in glandular cells at 1:500-1:1000 dilution.
Applications: WB-Ce,IHC-P
Shipping condition: Dry Ice

Reviews

Buy CTNNB1 polyclonal antibody now

Add to cart