PVRL1 polyclonal antibody View larger

PVRL1 polyclonal antibody

New product

455,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of PVRL1 polyclonal antibody

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesRabbit
ApplicationsWB-Ce,IHC-P,IF

More info about PVRL1 polyclonal antibody

Brand: Abnova
Reference: PAB29417
Product name: PVRL1 polyclonal antibody
Product description: Rabbit polyclonal antibody raised against recombinant human PVRL1.
Isotype: IgG
Gene id: 5818
Gene name: PVRL1
Gene alias: CD111|CLPED1|ED4|HIgR|HVEC|MGC142031|MGC16207|OFC7|PRR|PRR1|PVRR|PVRR1|SK-12|nectin-1
Gene description: poliovirus receptor-related 1 (herpesvirus entry mediator C)
Immunogen: Recombinant protein corresponding to human PVRL1.
Immunogen sequence/protein sequence: DSMYGFIGTDVVLHCSFANPLPSVKITQVTWQKSTNGSKQNVAIYNPSMGVSVLAPYRERVEFLRPSFTDGTIRLSRLELEDEGVYICEFATFPTGNRESQLNLTVMAKPTNWIEGTQAVLRAKKGQDD
Form: Liquid
Recommend dilutions: Immunohistochemistry (1:50-1:200)
Immunofluorescence (1-4 ug/mL)
Western Blot (1:100-1:250)
The optimal working dilution should be determined by the end user.
Storage buffer: In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Storage instruction: Store at 4°C. For long term storage store at -20°C.
Aliquot to avoid repeated freezing and thawing.
Note: This product contains sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
Product type: Primary antibodies
Host species: Rabbit
Antigen species / target species: Human
Reactivity: Human
Application image: PAB29417-48-38-1.jpg
Application image note: Immunohistochemical staining of human pancreas with PVRL1 polyclonal antibody (Cat # PAB29417) shows strong cytoplasmic and membranous positivity in intercalated ducts at 1:50-1:200 dilution.
Applications: WB-Ce,IHC-P,IF
Shipping condition: Dry Ice

Reviews

Buy PVRL1 polyclonal antibody now

Add to cart