EGFR polyclonal antibody View larger

EGFR polyclonal antibody

New product

455,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of EGFR polyclonal antibody

BrandAbnova
Product typePrimary antibodies
ReactivityHuman,Mouse,Rat
Host speciesRabbit
ApplicationsWB-Ce,IHC-P,IF

More info about EGFR polyclonal antibody

Brand: Abnova
Reference: PAB29416
Product name: EGFR polyclonal antibody
Product description: Rabbit polyclonal antibody raised against recombinant human EGFR.
Isotype: IgG
Gene id: 1956
Gene name: EGFR
Gene alias: ERBB|ERBB1|HER1|PIG61|mENA
Gene description: epidermal growth factor receptor (erythroblastic leukemia viral (v-erb-b) oncogene homolog, avian)
Immunogen: Recombinant protein corresponding to human EGFR.
Immunogen sequence/protein sequence: QQGFFSSPSTSRTPLLSSLSATSNNSTVACIDRNGLQSCPIKEDSFLQRYSSDPTGALTEDSIDDTFLPVPEYINQSVPKRPAGSVQNPVYHNQPLNPAPSRDPHYQDPHSTAVGNPEYLNTVQPTCVNSTFDSPAHWAQKGSHQISLD
Form: Liquid
Recommend dilutions: Immunohistochemistry (1:50-1:200)
Immunofluorescence (1-4 ug/mL)
Western Blot (1:100-1:250)
The optimal working dilution should be determined by the end user.
Storage buffer: In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Storage instruction: Store at 4°C. For long term storage store at -20°C.
Aliquot to avoid repeated freezing and thawing.
Note: This product contains sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
Product type: Primary antibodies
Host species: Rabbit
Antigen species / target species: Human
Reactivity: Human,Mouse,Rat
Application image: PAB29416-48-41-1.jpg
Application image note: Immunohistochemical staining of human placenta with EGFR polyclonal antibody (Cat # PAB29416) shows strong cytoplasmic positivity in trophoblastic cells at 1:50-1:200 dilution.
Applications: WB-Ce,IHC-P,IF
Shipping condition: Dry Ice

Reviews

Buy EGFR polyclonal antibody now

Add to cart