FBXO44 polyclonal antibody View larger

FBXO44 polyclonal antibody

New product

455,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of FBXO44 polyclonal antibody

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesRabbit
ApplicationsIHC-P,IF,WB-Tr

More info about FBXO44 polyclonal antibody

Brand: Abnova
Reference: PAB29402
Product name: FBXO44 polyclonal antibody
Product description: Rabbit polyclonal antibody raised against recombinant human FBXO44.
Isotype: IgG
Gene id: 93611
Gene name: FBXO44
Gene alias: DKFZp781J0852|FBG3|FBX30|FBX6A|Fbx44|Fbxo6a|MGC14140
Gene description: F-box protein 44
Immunogen: Recombinant protein corresponding to human FBXO44.
Immunogen sequence/protein sequence: SLHRNLLHNPCAEEGFEFWSLDVNGGDEWKVEDLSRDQRKEFPNDQVRSQARLRVQVPAVRSAPVVRARASGDLPARPGDHPAEERCQVEGGLPHILQLP
Form: Liquid
Recommend dilutions: Immunohistochemistry (1:200-1:500)
Immunofluorescence (1-4 ug/mL)
Western Blot (1:500-1:1000)
The optimal working dilution should be determined by the end user.
Storage buffer: In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Storage instruction: Store at 4°C. For long term storage store at -20°C.
Aliquot to avoid repeated freezing and thawing.
Note: This product contains sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
Product type: Primary antibodies
Host species: Rabbit
Antigen species / target species: Human
Reactivity: Human
Application image: PAB29402-48-51-1.jpg
Application image note: Immunohistochemical staining of human cerebral cortex with FBXO44 polyclonal antibody (Cat # PAB29402) shows strong nuclear and cytoplasmic positivity in neuronal cells at 1:200-1:500 dilution.
Applications: IHC-P,IF,WB-Tr
Shipping condition: Dry Ice

Reviews

Buy FBXO44 polyclonal antibody now

Add to cart