WSB1 polyclonal antibody View larger

WSB1 polyclonal antibody

New product

455,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of WSB1 polyclonal antibody

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesRabbit
ApplicationsIHC-P,IF,WB-Tr

More info about WSB1 polyclonal antibody

Brand: Abnova
Reference: PAB29394
Product name: WSB1 polyclonal antibody
Product description: Rabbit polyclonal antibody raised against recombinant human WSB1.
Isotype: IgG
Gene id: 26118
Gene name: WSB1
Gene alias: SWIP1|WSB-1
Gene description: WD repeat and SOCS box-containing 1
Immunogen: Recombinant protein corresponding to human WSB1.
Immunogen sequence/protein sequence: APFDKKCGRENWTVAFAPDGSYFAWSQGHRTVKLVPWSQCLQNFLLHGTKNVTNSSSLRLPRQNSDGGQKNKPREHIIDCGDIVWSLAFGSSVPEKQSRCVNIEWHRFRFGQDQLLLATGLNNGRIKIWDV
Form: Liquid
Recommend dilutions: Immunohistochemistry (1:50-1:200)
Immunofluorescence (1-4 ug/mL)
Western Blot (1:250-1:500)
The optimal working dilution should be determined by the end user.
Storage buffer: In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Storage instruction: Store at 4°C. For long term storage store at -20°C.
Aliquot to avoid repeated freezing and thawing.
Note: This product contains sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
Product type: Primary antibodies
Host species: Rabbit
Antigen species / target species: Human
Reactivity: Human
Application image: PAB29394-48-8-1.jpg
Application image note: Immunohistochemical staining of human liver with WSB1 polyclonal antibody (Cat # PAB29394) shows cytoplasmic and membranous positivity in hepatocytes at 1:50-1:200 dilution.
Applications: IHC-P,IF,WB-Tr
Shipping condition: Dry Ice

Reviews

Buy WSB1 polyclonal antibody now

Add to cart