PHB polyclonal antibody View larger

PHB polyclonal antibody

New product

455,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of PHB polyclonal antibody

BrandAbnova
Product typePrimary antibodies
ReactivityHuman,Mouse,Rat
Host speciesRabbit
ApplicationsWB-Ce,IHC-P,IF

More info about PHB polyclonal antibody

Brand: Abnova
Reference: PAB29392
Product name: PHB polyclonal antibody
Product description: Rabbit polyclonal antibody raised against recombinant human PHB.
Isotype: IgG
Gene id: 5245
Gene name: PHB
Gene alias: PHB1
Gene description: prohibitin
Immunogen: Recombinant protein corresponding to human PHB.
Immunogen sequence/protein sequence: DVSLTHLTFGKEFTEAVEAKQVAQQEAERARFVVEKAEQQKKAAIISAEGDSKAAELIANSLATAGDGLIELRKLEAAEDIAYQLSRSRNITYLP
Form: Liquid
Recommend dilutions: Immunohistochemistry (1:200-1:500)
Immunofluorescence (1-4 ug/mL)
Western Blot (1:100-1:250)
The optimal working dilution should be determined by the end user.
Storage buffer: In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Storage instruction: Store at 4°C. For long term storage store at -20°C.
Aliquot to avoid repeated freezing and thawing.
Note: This product contains sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
Product type: Primary antibodies
Host species: Rabbit
Antigen species / target species: Human
Reactivity: Human,Mouse,Rat
Application image: PAB29392-48-4-1.jpg
Application image note: Immunohistochemical staining of human stomach with PHB polyclonal antibody (Cat # PAB29392) shows strong cytoplasmic positivity, with a granular pattern, in glandular cells at 1:200-1:500 dilution.
Applications: WB-Ce,IHC-P,IF
Shipping condition: Dry Ice

Reviews

Buy PHB polyclonal antibody now

Add to cart