Brand | Abnova |
Product type | Primary antibodies |
Reactivity | Human |
Host species | Rabbit |
Applications | IHC-P,IF,WB-Tr |
Brand: | Abnova |
Reference: | PAB29383 |
Product name: | CEBPE polyclonal antibody |
Product description: | Rabbit polyclonal antibody raised against recombinant human CEBPE. |
Isotype: | IgG |
Gene id: | 1053 |
Gene name: | CEBPE |
Gene alias: | C/EBP-epsilon|CRP1 |
Gene description: | CCAAT/enhancer binding protein (C/EBP), epsilon |
Immunogen: | Recombinant protein corresponding to human CEBPE. |
Immunogen sequence/protein sequence: | SHGTYYECEPRGGQQPLEFSGGRAGPGELGDMCEHEASIDLSAYIESGEEQLLSDLFAVKPAPEARGLKGPGTPAFPHYLPPDPRPFAYPPHTFGPDRKALGPGIYSSPGSYDPRAVAVKEEPR |
Form: | Liquid |
Recommend dilutions: | Immunohistochemistry (1:50-1:200) Immunofluorescence (1-4 ug/mL) Western Blot (1:100-1:250) The optimal working dilution should be determined by the end user. |
Storage buffer: | In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide) |
Storage instruction: | Store at 4°C. For long term storage store at -20°C. Aliquot to avoid repeated freezing and thawing. |
Note: | This product contains sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only. |
Product type: | Primary antibodies |
Host species: | Rabbit |
Antigen species / target species: | Human |
Reactivity: | Human |
Application image: | ![]() |
Application image note: | Immunohistochemical staining of human bone marrow with CEBPE polyclonal antibody (Cat # PAB29383) shows strong nuclear positivity in bone marrow poietic cells at 1:50-1:200 dilution. |
Applications: | IHC-P,IF,WB-Tr |
Shipping condition: | Dry Ice |