CDKN1C polyclonal antibody View larger

CDKN1C polyclonal antibody

New product

455,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of CDKN1C polyclonal antibody

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesRabbit
ApplicationsWB-Ce,IHC-P,IF

More info about CDKN1C polyclonal antibody

Brand: Abnova
Reference: PAB29381
Product name: CDKN1C polyclonal antibody
Product description: Rabbit polyclonal antibody raised against recombinant human CDKN1C.
Isotype: IgG
Gene id: 1028
Gene name: CDKN1C
Gene alias: BWCR|BWS|KIP2|WBS|p57
Gene description: cyclin-dependent kinase inhibitor 1C (p57, Kip2)
Immunogen: Recombinant protein corresponding to human CDKN1C.
Immunogen sequence/protein sequence: TMERLVARGTFPVLVRTSACRSLFGPVDHEELSRELQARLAELNAEDQNRWDYDFQQDMPLRGPGRLQWTEVDSDSVPAFYRETVQVGRCRLLLAPRPVAVAVAVSPPLEPAAESLDGLEEAPEQLPSVPVP
Form: Liquid
Recommend dilutions: Immunohistochemistry (1:50-1:200)
Immunofluorescence (1-4 ug/mL)
Western Blot (1:100-1:250)
The optimal working dilution should be determined by the end user.
Storage buffer: In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Storage instruction: Store at 4°C. For long term storage store at -20°C.
Aliquot to avoid repeated freezing and thawing.
Note: This product contains sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
Product type: Primary antibodies
Host species: Rabbit
Antigen species / target species: Human
Reactivity: Human
Application image: PAB29381-48-41-1.jpg
Application image note: Immunohistochemical staining of human placenta with CDKN1C polyclonal antibody (Cat # PAB29381) shows strong nuclear positivity in trophoblastic cells and decidual cells at 1:50-1:200 dilution.
Applications: WB-Ce,IHC-P,IF
Shipping condition: Dry Ice

Reviews

Buy CDKN1C polyclonal antibody now

Add to cart