CDKL5 polyclonal antibody View larger

CDKL5 polyclonal antibody

New product

455,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of CDKL5 polyclonal antibody

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesRabbit
ApplicationsIHC-P,IF

More info about CDKL5 polyclonal antibody

Brand: Abnova
Reference: PAB29377
Product name: CDKL5 polyclonal antibody
Product description: Rabbit polyclonal antibody raised against recombinant human CDKL5.
Isotype: IgG
Gene id: 6792
Gene name: CDKL5
Gene alias: ISSX|STK9
Gene description: cyclin-dependent kinase-like 5
Immunogen: Recombinant protein corresponding to human CDKL5.
Immunogen sequence/protein sequence: AARANSLQLLSPQPGEQLPPEMTVARSSVKETSREGTSSFHTRQKSEGGVYHDPHSDDGTAPKENRHLYNDPVPRRVGSFYRVPSPRPDNSFHENNVSTRVSSLPSESSSGTNHSKRQPAFDP
Form: Liquid
Recommend dilutions: Immunohistochemistry (1:200-1:500)
Immunofluorescence (1-4 ug/mL)
The optimal working dilution should be determined by the end user.
Storage buffer: In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Storage instruction: Store at 4°C. For long term storage store at -20°C.
Aliquot to avoid repeated freezing and thawing.
Note: This product contains sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
Product type: Primary antibodies
Host species: Rabbit
Antigen species / target species: Human
Reactivity: Human
Application image: PAB29377-48-7-1.jpg
Application image note: Immunohistochemical staining of human colon with CDKL5 polyclonal antibody (Cat # PAB29377) shows strong nuclear positivity in glandular cells.
Applications: IHC-P,IF
Shipping condition: Dry Ice

Reviews

Buy CDKL5 polyclonal antibody now

Add to cart