ZNF81 polyclonal antibody View larger

ZNF81 polyclonal antibody

PAB29374_100uL

New product

455,00 € tax excl.

100 UL

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of ZNF81 polyclonal antibody

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesRabbit
ApplicationsIHC-P,IF

More info about ZNF81 polyclonal antibody

Brand: Abnova
Reference: PAB29374
Product name: ZNF81 polyclonal antibody
Product description: Rabbit polyclonal antibody raised against recombinant human ZNF81.
Isotype: IgG
Gene id: 347344
Gene name: ZNF81
Gene alias: FLJ44367|HFZ20|MRX45
Gene description: zinc finger protein 81
Immunogen: Recombinant protein corresponding to human ZNF81.
Immunogen sequence/protein sequence: VHPSPNLILSQKRPHKRDSFGKSFKHNLDLHIHNKSNAAKNLDKTIGHGQVFTQNSSYSHHENTHTGVKFCERNQCGKVLSLKHSLSQNVKFPIGEKANTCT
Form: Liquid
Recommend dilutions: Immunohistochemistry (1:200-1:500)
Immunofluorescence (1-4 ug/mL)
The optimal working dilution should be determined by the end user.
Storage buffer: In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Storage instruction: Store at 4°C. For long term storage store at -20°C.
Aliquot to avoid repeated freezing and thawing.
Note: This product contains sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
Product type: Primary antibodies
Host species: Rabbit
Antigen species / target species: Human
Reactivity: Human
Application image: PAB29374-48-7-1.jpg
Application image note: Immunohistochemical staining of human colon with ZNF81 polyclonal antibody (Cat # PAB29374) shows strong cytoplasmic positivity in glandular cells, ganglion cells were moderately stained.
Applications: IHC-P,IF
Shipping condition: Dry Ice

Reviews

Buy ZNF81 polyclonal antibody now

Add to cart