PTPN6 polyclonal antibody View larger

PTPN6 polyclonal antibody

New product

455,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of PTPN6 polyclonal antibody

BrandAbnova
Product typePrimary antibodies
ReactivityHuman,Rat
Host speciesRabbit
ApplicationsWB-Ce,IHC-P,IF

More info about PTPN6 polyclonal antibody

Brand: Abnova
Reference: PAB29368
Product name: PTPN6 polyclonal antibody
Product description: Rabbit polyclonal antibody raised against recombinant human PTPN6.
Isotype: IgG
Gene id: 5777
Gene name: PTPN6
Gene alias: HCP|HCPH|HPTP1C|PTP-1C|SH-PTP1|SHP-1|SHP-1L|SHP1
Gene description: protein tyrosine phosphatase, non-receptor type 6
Immunogen: Recombinant protein corresponding to human PTPN6.
Immunogen sequence/protein sequence: HAGPIIVHCSAGIGRTGTIIVIDMLMENISTKGLDCDIDIQKTIQMVRAQRSGMVQTEAQYKFIYVAIAQFIETTKKKLEVLQSQKGQESEYGNITYPPAMKNAHAKASRTSSKHKEDVYENLHTKNKREEKVKKQRSADKEKSKGSLK
Form: Liquid
Recommend dilutions: Immunohistochemistry (1:200-1:500)
Immunofluorescence (1-4 ug/mL)
Western Blot (1:100-1:250)
The optimal working dilution should be determined by the end user.
Storage buffer: In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Storage instruction: Store at 4°C. For long term storage store at -20°C.
Aliquot to avoid repeated freezing and thawing.
Note: This product contains sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
Product type: Primary antibodies
Host species: Rabbit
Antigen species / target species: Human
Reactivity: Human,Rat
Application image: PAB29368-48-10-1.jpg
Application image note: Immunohistochemical staining of human lymph node with PTPN6 polyclonal antibody (Cat # PAB29368) shows strong cytoplasmic positivity in reaction center cells and lymphoid cells outside reaction centra at 1:200-1:500 dilution.
Applications: WB-Ce,IHC-P,IF
Shipping condition: Dry Ice

Reviews

Buy PTPN6 polyclonal antibody now

Add to cart