SOD1 polyclonal antibody View larger

SOD1 polyclonal antibody

New product

455,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of SOD1 polyclonal antibody

BrandAbnova
Product typePrimary antibodies
ReactivityHuman,Mouse,Rat
Host speciesRabbit
ApplicationsWB-Ce,IHC-P

More info about SOD1 polyclonal antibody

Brand: Abnova
Reference: PAB29364
Product name: SOD1 polyclonal antibody
Product description: Rabbit polyclonal antibody raised against recombinant human SOD1.
Isotype: IgG
Gene id: 6647
Gene name: SOD1
Gene alias: ALS|ALS1|IPOA|SOD|homodimer
Gene description: superoxide dismutase 1, soluble
Immunogen: Recombinant protein corresponding to human SOD1.
Immunogen sequence/protein sequence: PVQGIINFEQKESNGPVKVWGSIKGLTEGLHGFHVHEFGDNTAGCTSAGPHFNPLSRKHGGPKDEERHVGDLGNVTADKDGVADVSIEDSVISLSGDHCIIGRTLVVHEKADDLGKGGNEESTKTGNAGSRLACG
Form: Liquid
Recommend dilutions: Immunohistochemistry (1:2500-1:5000)
Immunofluorescence (1-4 ug/mL)
Western Blot (1:250-1:500)
The optimal working dilution should be determined by the end user.
Storage buffer: In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Storage instruction: Store at 4°C. For long term storage store at -20°C.
Aliquot to avoid repeated freezing and thawing.
Note: This product contains sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
Product type: Primary antibodies
Host species: Rabbit
Antigen species / target species: Human
Reactivity: Human,Mouse,Rat
Application image: PAB29364-48-8-1.jpg
Application image note: Immunohistochemical staining of human liver with SOD1 polyclonal antibody (Cat # PAB29364) shows nuclear and cytoplasmic positivity in hepatocytes at 1:2500-1:5000 dilution.
Applications: WB-Ce,IHC-P
Shipping condition: Dry Ice

Reviews

Buy SOD1 polyclonal antibody now

Add to cart