NMT2 polyclonal antibody View larger

NMT2 polyclonal antibody

New product

455,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of NMT2 polyclonal antibody

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesRabbit
ApplicationsWB-Ce,IHC-P,IF

More info about NMT2 polyclonal antibody

Brand: Abnova
Reference: PAB29360
Product name: NMT2 polyclonal antibody
Product description: Rabbit polyclonal antibody raised against recombinant human NMT2.
Isotype: IgG
Gene id: 9397
Gene name: NMT2
Gene alias: -
Gene description: N-myristoyltransferase 2
Immunogen: Recombinant protein corresponding to human NMT2.
Immunogen sequence/protein sequence: GGTKSDSASDSQEIKIQQPSKNPSVPMQKLQDIQRAMELLSACQGPARNIDEAAKHRYQFWDTQPVPKLDEVITSHGAIEPDKDNVRQEPYSLPQGFMWDTLDLSDAEVLKELYTLLNENYVEDDDNMFRFDYSPEFLLWALRPPGWLL
Form: Liquid
Recommend dilutions: Immunohistochemistry (1:500-1:1000)
Immunofluorescence (1-4 ug/mL)
Western Blot (1:100-1:250)
The optimal working dilution should be determined by the end user.
Storage buffer: In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Storage instruction: Store at 4°C. For long term storage store at -20°C.
Aliquot to avoid repeated freezing and thawing.
Note: This product contains sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
Product type: Primary antibodies
Host species: Rabbit
Antigen species / target species: Human
Reactivity: Human
Application image: PAB29360-48-12-1.jpg
Application image note: Immunohistochemical staining of human testis with NMT2 polyclonal antibody (Cat # PAB29360) shows strong cytoplasmic positivity in cells in seminiferus ducts at 1:500-1:1000 dilution.
Applications: WB-Ce,IHC-P,IF
Shipping condition: Dry Ice

Reviews

Buy NMT2 polyclonal antibody now

Add to cart