HIF1A polyclonal antibody View larger

HIF1A polyclonal antibody

New product

455,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of HIF1A polyclonal antibody

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesRabbit
ApplicationsIHC-P,IF

More info about HIF1A polyclonal antibody

Brand: Abnova
Reference: PAB29359
Product name: HIF1A polyclonal antibody
Product description: Rabbit polyclonal antibody raised against recombinant human HIF1A.
Isotype: IgG
Gene id: 3091
Gene name: HIF1A
Gene alias: HIF-1alpha|HIF1|HIF1-ALPHA|MOP1|PASD8|bHLHe78
Gene description: hypoxia inducible factor 1, alpha subunit (basic helix-loop-helix transcription factor)
Immunogen: Recombinant protein corresponding to human HIF1A.
Immunogen sequence/protein sequence: KSHPRSPNVLSVALSQRTTVPEEELNPKILALQNAQRKRKMEHDGSLFQAVGIGTLLQQPDDHAATTSLSWKRVKGCKSSEQNGMEQKTIILIPSDLACRLLGQSMDESGLPQLTSYDCEVNAPIQGSRNLLQGEELLRALD
Form: Liquid
Recommend dilutions: Immunohistochemistry (1:200-1:500)
Immunofluorescence (1-4 ug/mL)
The optimal working dilution should be determined by the end user.
Storage buffer: In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Storage instruction: Store at 4°C. For long term storage store at -20°C.
Aliquot to avoid repeated freezing and thawing.
Note: This product contains sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
Product type: Primary antibodies
Host species: Rabbit
Antigen species / target species: Human
Reactivity: Human
Application image: PAB29359-48-5-1.jpg
Application image note: Immunohistochemical staining of human tonsil with HIF1A polyclonal antibody (Cat # PAB29359) shows moderate cytoplasmic positivity in reaction center cells and lymphoid cells outside reaction center.
Applications: IHC-P,IF
Shipping condition: Dry Ice

Reviews

Buy HIF1A polyclonal antibody now

Add to cart