SH3BP1 polyclonal antibody View larger

SH3BP1 polyclonal antibody

New product

455,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of SH3BP1 polyclonal antibody

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesRabbit
ApplicationsWB-Ce,IHC-P,IF

More info about SH3BP1 polyclonal antibody

Brand: Abnova
Reference: PAB29348
Product name: SH3BP1 polyclonal antibody
Product description: Rabbit polyclonal antibody raised against recombinant human SH3BP1.
Isotype: IgG
Gene id: 23616
Gene name: SH3BP1
Gene alias: -
Gene description: SH3-domain binding protein 1
Immunogen: Recombinant protein corresponding to human SH3BP1.
Immunogen sequence/protein sequence: ENLSNLRYLMKFLARLAEEQEVNKMTPSNIAIVLGPNLLWPPEKEGDQAQLDAASVSSIQVVGVVEALIQSADTLFPGDINFNVSGLFSAVTLQDTVSDRLASEELPSTAVPTPATTPAPAPAPAPAPAPALASAATKERTESEVPP
Form: Liquid
Recommend dilutions: Immunohistochemistry (1:20-1:50)
Immunofluorescence (1-4 ug/mL)
Western Blot (1:100-1:250)
The optimal working dilution should be determined by the end user.
Storage buffer: In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Storage instruction: Store at 4°C. For long term storage store at -20°C.
Aliquot to avoid repeated freezing and thawing.
Note: This product contains sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
Product type: Primary antibodies
Host species: Rabbit
Antigen species / target species: Human
Reactivity: Human
Application image: PAB29348-48-7-1.jpg
Application image note: Immunohistochemical staining of human colon with SH3BP1 polyclonal antibody (Cat # PAB29348) shows cytoplasmic positivity in glandular cells at 1:20-1:50 dilution.
Applications: WB-Ce,IHC-P,IF
Shipping condition: Dry Ice

Reviews

Buy SH3BP1 polyclonal antibody now

Add to cart