ZEB1 polyclonal antibody View larger

ZEB1 polyclonal antibody

New product

455,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of ZEB1 polyclonal antibody

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesRabbit
ApplicationsWB-Ce,IHC-P,IF

More info about ZEB1 polyclonal antibody

Brand: Abnova
Reference: PAB29343
Product name: ZEB1 polyclonal antibody
Product description: Rabbit polyclonal antibody raised against recombinant human ZEB1.
Isotype: IgG
Gene id: 6935
Gene name: ZEB1
Gene alias: AREB6|BZP|DELTA-EF1|MGC133261|NIL-2-A|NIL-2A|NIL2A|TCF8|ZEB|ZFHEP|ZFHX1A
Gene description: zinc finger E-box binding homeobox 1
Immunogen: Recombinant protein corresponding to amino acids of human ZEB1.
Immunogen sequence/protein sequence: EAEKPESSVSSATGDGNLSPSQPPLKNLLSLLKAYYALNAQPSAEELSKIADSVNLPLDVVKKWFEKMQAGQISVQSSEPSSPEPGKVNIPAKNNDQPQSANANEPQDSTVNLQSPLKMTNSPVLPVGST
Protein accession: P37275
Form: Liquid
Recommend dilutions: Immunohistochemistry (1:500-1:1000)
Western Blot (1:200-1:500)
Immunofluorescence (1-4 ug/mL)
The optimal working dilution should be determined by the end user.
Storage buffer: In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Storage instruction: Store at 4°C. For long term storage store at -20°C.
Aliquot to avoid repeated freezing and thawing.
Note: This product contains sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
Product type: Primary antibodies
Host species: Rabbit
Antigen species / target species: Human
Reactivity: Human
Application image: PAB29343-48-51-1.jpg
Application image note: Immunohistochemical staining of human cerebral cortex with ZEB1 polyclonal antibody (Cat# PAB29343) shows strong nuclear positivity in glial cells at 1:500-1:1000 dilution.
Applications: WB-Ce,IHC-P,IF
Shipping condition: Dry Ice

Reviews

Buy ZEB1 polyclonal antibody now

Add to cart