RPL30 polyclonal antibody View larger

RPL30 polyclonal antibody

New product

455,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of RPL30 polyclonal antibody

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesRabbit
ApplicationsWB,IHC-P,IF

More info about RPL30 polyclonal antibody

Brand: Abnova
Reference: PAB29336
Product name: RPL30 polyclonal antibody
Product description: Rabbit polyclonal antibody raised against recombinant human RPL30.
Isotype: IgG
Gene id: 6156
Gene name: RPL30
Gene alias: -
Gene description: ribosomal protein L30
Immunogen: Recombinant protein corresponding to amino acids of human RPL30.
Immunogen sequence/protein sequence: INSRLQLVMKSGKYVLGYKQTLKMIRQGKAKLVILANNCPALRKSEIEYYAMLAKTGVHHYSGNNIELGTACGKYYRVCTLAIIDPGDSDIIRSMPEQTGEK
Protein accession: P62888
Form: Liquid
Recommend dilutions: Immunohistochemistry (1:200-1:500)
Western Blot (1:100-1:250)
Immunofluorescence (1-4 ug/mL)
The optimal working dilution should be determined by the end user.
Storage buffer: In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Storage instruction: Store at 4°C. For long term storage store at -20°C.
Aliquot to avoid repeated freezing and thawing.
Note: This product contains sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
Product type: Primary antibodies
Host species: Rabbit
Antigen species / target species: Human
Reactivity: Human
Application image: PAB29336-48-52-1.jpg
Application image note: Immunohistochemical staining of human cerebellum with RPL30 polyclonal antibody (Cat# PAB29336) shows cytoplasmic positivity in purkinje cells and cells of molecular layer at 1:200-1:500 dilution.
Applications: WB,IHC-P,IF
Shipping condition: Dry Ice

Reviews

Buy RPL30 polyclonal antibody now

Add to cart