CASP3 polyclonal antibody View larger

CASP3 polyclonal antibody

New product

455,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of CASP3 polyclonal antibody

BrandAbnova
Product typePrimary antibodies
ReactivityHuman,Mouse,Rat
Host speciesRabbit
ApplicationsWB-Ce,IHC-P,IF

More info about CASP3 polyclonal antibody

Brand: Abnova
Reference: PAB29334
Product name: CASP3 polyclonal antibody
Product description: Rabbit polyclonal antibody raised against recombinant human CASP3.
Isotype: IgG
Gene id: 836
Gene name: CASP3
Gene alias: CPP32|CPP32B|SCA-1
Gene description: caspase 3, apoptosis-related cysteine peptidase
Immunogen: Recombinant protein corresponding to amino acids of human CASP3.
Immunogen sequence/protein sequence: HGSESMDSGISLDNSYKMDYPEMGLCIIINNKNFHKSTGMTSRSGTDVDAANLRETFRNLKYEVRNKNDLTREEIVELMRDVSKEDHSKRSSFVCVLLSHGEEGIIFGTNGPVDL
Protein accession: A8MVM1
Form: Liquid
Recommend dilutions: Immunohistochemistry (1:500-1:1000)
Western Blot (1:100-1:250)
Immunofluorescence (1-4 ug/mL)
The optimal working dilution should be determined by the end user.
Storage buffer: In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Storage instruction: Store at 4°C. For long term storage store at -20°C.
Aliquot to avoid repeated freezing and thawing.
Note: This product contains sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
Product type: Primary antibodies
Host species: Rabbit
Antigen species / target species: Human
Reactivity: Human,Mouse,Rat
Application image: PAB29334-48-70-1.jpg
Application image note: Immunohistochemical staining of human bone marrow with CASP3 polyclonal antibody (Cat# PAB29334) shows strong cytoplasmic positivity in bone marrow poietic cells at 1:500-1:1000 dilution.
Applications: WB-Ce,IHC-P,IF
Shipping condition: Dry Ice

Reviews

Buy CASP3 polyclonal antibody now

Add to cart