Brand | Abnova |
Product type | Primary antibodies |
Reactivity | Human,Mouse,Rat |
Host species | Rabbit |
Applications | WB-Ce,IHC-P,IF |
Brand: | Abnova |
Reference: | PAB29334 |
Product name: | CASP3 polyclonal antibody |
Product description: | Rabbit polyclonal antibody raised against recombinant human CASP3. |
Isotype: | IgG |
Gene id: | 836 |
Gene name: | CASP3 |
Gene alias: | CPP32|CPP32B|SCA-1 |
Gene description: | caspase 3, apoptosis-related cysteine peptidase |
Immunogen: | Recombinant protein corresponding to amino acids of human CASP3. |
Immunogen sequence/protein sequence: | HGSESMDSGISLDNSYKMDYPEMGLCIIINNKNFHKSTGMTSRSGTDVDAANLRETFRNLKYEVRNKNDLTREEIVELMRDVSKEDHSKRSSFVCVLLSHGEEGIIFGTNGPVDL |
Protein accession: | A8MVM1 |
Form: | Liquid |
Recommend dilutions: | Immunohistochemistry (1:500-1:1000) Western Blot (1:100-1:250) Immunofluorescence (1-4 ug/mL) The optimal working dilution should be determined by the end user. |
Storage buffer: | In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide) |
Storage instruction: | Store at 4°C. For long term storage store at -20°C. Aliquot to avoid repeated freezing and thawing. |
Note: | This product contains sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only. |
Product type: | Primary antibodies |
Host species: | Rabbit |
Antigen species / target species: | Human |
Reactivity: | Human,Mouse,Rat |
Application image: | ![]() |
Application image note: | Immunohistochemical staining of human bone marrow with CASP3 polyclonal antibody (Cat# PAB29334) shows strong cytoplasmic positivity in bone marrow poietic cells at 1:500-1:1000 dilution. |
Applications: | WB-Ce,IHC-P,IF |
Shipping condition: | Dry Ice |