CD34 polyclonal antibody View larger

CD34 polyclonal antibody

New product

455,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of CD34 polyclonal antibody

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesRabbit
ApplicationsWB,IHC-P,IF

More info about CD34 polyclonal antibody

Brand: Abnova
Reference: PAB29333
Product name: CD34 polyclonal antibody
Product description: Rabbit polyclonal antibody raised against recombinant human CD34.
Isotype: IgG
Gene id: 997
Gene name: CDC34
Gene alias: E2-CDC34|UBC3|UBE2R1
Gene description: cell division cycle 34 homolog (S. cerevisiae)
Immunogen: Recombinant protein corresponding to amino acids of human CD34.
Immunogen sequence/protein sequence: LNEPNTFSPANVDASVMYRKWKESKGKDREYTDIIRKQVLGTKVDAERDGVKVPTTLAEYCVKTKAPAPDEGSDLFYDDYYEDGEVEEEADSCFGDDEDDSGT
Protein accession: P49427
Form: Liquid
Recommend dilutions: Immunohistochemistry (1:50-1:200)
Western Blot (1:100-1:250)
Immunofluorescence (1-4 ug/mL)
The optimal working dilution should be determined by the end user.
Storage buffer: In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Storage instruction: Store at 4°C. For long term storage store at -20°C.
Aliquot to avoid repeated freezing and thawing.
Note: This product contains sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
Product type: Primary antibodies
Host species: Rabbit
Antigen species / target species: Human
Reactivity: Human
Application image: PAB29333-48-2-1.jpg
Application image note: Immunohistochemical staining of human kidney with CD34 polyclonal antibody (Cat# PAB29333) shows strong cytoplasmic positivity in cells of tubules at 1:50-1:200 dilution.
Applications: WB,IHC-P,IF
Shipping condition: Dry Ice

Reviews

Buy CD34 polyclonal antibody now

Add to cart