WAS polyclonal antibody View larger

WAS polyclonal antibody

New product

455,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of WAS polyclonal antibody

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesRabbit
ApplicationsIHC-P,IF

More info about WAS polyclonal antibody

Brand: Abnova
Reference: PAB29323
Product name: WAS polyclonal antibody
Product description: Rabbit polyclonal antibody raised against recombinant human WAS.
Isotype: IgG
Gene id: 7454
Gene name: WAS
Gene alias: IMD2|THC|WASP
Gene description: Wiskott-Aldrich syndrome (eczema-thrombocytopenia)
Immunogen: Recombinant protein corresponding to amino acids of human WAS.
Immunogen sequence/protein sequence: LQAGRLLWEQELYSQLVYSTPTPFFHTFAGDDCQAGLNFADEDEAQAFRALVQEKIQKRNQRQSGDRRQLPPPPTPANEERRGGLPPLPLHPGGDQGGPPVGPLSLGLATVDIQNPDITSSRYRGLPAPGPSPADKKRSGKK
Protein accession: P42768
Form: Liquid
Recommend dilutions: Immunohistochemistry (1:200-1:500)
Immunofluorescence (1-4 ug/mL)
The optimal working dilution should be determined by the end user.
Storage buffer: In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Storage instruction: Store at 4°C. For long term storage store at -20°C.
Aliquot to avoid repeated freezing and thawing.
Note: This product contains sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
Product type: Primary antibodies
Host species: Rabbit
Antigen species / target species: Human
Reactivity: Human
Application image: PAB29323-48-9-1.jpg
Application image note: Immunohistochemical staining of human spleen with WAS polyclonal antibody (Cat# PAB29323) shows strong cytoplasmic positivity in cells in red pulp and cells in white pulp.
Applications: IHC-P,IF
Shipping condition: Dry Ice

Reviews

Buy WAS polyclonal antibody now

Add to cart