MLLT3 polyclonal antibody View larger

MLLT3 polyclonal antibody

New product

455,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of MLLT3 polyclonal antibody

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesRabbit
ApplicationsIHC-P,IF,WB-Tr

More info about MLLT3 polyclonal antibody

Brand: Abnova
Reference: PAB29315
Product name: MLLT3 polyclonal antibody
Product description: Rabbit polyclonal antibody raised against recombinant human MLLT3.
Isotype: IgG
Gene id: 4300
Gene name: MLLT3
Gene alias: AF9|FLJ2035|YEATS3
Gene description: myeloid/lymphoid or mixed-lineage leukemia (trithorax homolog, Drosophila); translocated to, 3
Immunogen: Recombinant protein corresponding to amino acids of human MLLT3.
Immunogen sequence/protein sequence: SSKSDSEQPSPASSSSSSSSSFTPSQTRQQGPLRSIMKDLHSDDNEEESDEVEDNDNDSEMERPVNRGGSRSRRVSLSDGSDSESSSASSPLHHEPPPPLLKTNNNQILEVKSPIKQSKSDKQIKNGECDKAYLDELVELHRRLMTLR
Protein accession: B7Z755
Form: Liquid
Recommend dilutions: Immunohistochemistry (1:50-1:200)
Western Blot (1:100-1:250)
Immunofluorescence (1-4 ug/mL)
The optimal working dilution should be determined by the end user.
Storage buffer: In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Storage instruction: Store at 4°C. For long term storage store at -20°C.
Aliquot to avoid repeated freezing and thawing.
Note: This product contains sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
Product type: Primary antibodies
Host species: Rabbit
Antigen species / target species: Human
Reactivity: Human
Application image: PAB29315-48-52-1.jpg
Application image note: Immunohistochemical staining of human cerebellum with MLLT3 polyclonal antibody (Cat# PAB29315) shows strong nuclear positivity in purkinje cells at 1:50-1:200 dilution.
Applications: IHC-P,IF,WB-Tr
Shipping condition: Dry Ice

Reviews

Buy MLLT3 polyclonal antibody now

Add to cart