Brand | Abnova |
Product type | Primary antibodies |
Reactivity | Human |
Host species | Rabbit |
Applications | WB-Ce,IHC-P,IF |
Brand: | Abnova |
Reference: | PAB29312 |
Product name: | ENG polyclonal antibody |
Product description: | Rabbit polyclonal antibody raised against recombinant human ENG. |
Isotype: | IgG |
Gene id: | 2022 |
Gene name: | ENG |
Gene alias: | CD105|END|FLJ41744|HHT1|ORW|ORW1 |
Gene description: | endoglin |
Immunogen: | Recombinant protein corresponding to amino acids 312-438 of human ENG. |
Immunogen sequence/protein sequence: | ASFVELPLASIVSLHASSCGGRLQTSPAPIQTTPPKDTCSPELLMSLIQTKCADDAMTLVLKKELVAHLKCTITGLTFWDPSCEAEDRGDKFVLRSAYSSCGMQVSASMISNEAVVNILSSSSPQRK |
Protein accession: | P17813 |
Form: | Liquid |
Recommend dilutions: | Immunofluorescence (1-4 ug/mL) Immunohistochemistry (1:200-1:500) Western Blot (1:100-1:250) The optimal working dilution should be determined by the end user. |
Storage buffer: | In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide) |
Storage instruction: | Store at 4°C. For long term storage store at -20°C. Aliquot to avoid repeated freezing and thawing. |
Note: | This product contains sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only. |
Product type: | Primary antibodies |
Host species: | Rabbit |
Antigen species / target species: | Human |
Reactivity: | Human |
Application image: | ![]() |
Application image note: | Immunofluorescence staining of U-251 MG cells with ENG polyclonal antibody (Cat# PAB29312) under 1-4 ug/mL working concentration. |
Applications: | WB-Ce,IHC-P,IF |
Shipping condition: | Dry Ice |