Brand | Abnova |
Product type | Primary antibodies |
Reactivity | Human |
Host species | Rabbit |
Applications | IHC-P,IF,WB-Tr |
Brand: | Abnova |
Reference: | PAB29311 |
Product name: | CD79B polyclonal antibody |
Product description: | Rabbit polyclonal antibody raised against recombinant human CD79B. |
Isotype: | IgG |
Gene id: | 974 |
Gene name: | CD79B |
Gene alias: | B29|IGB |
Gene description: | CD79b molecule, immunoglobulin-associated beta |
Immunogen: | Recombinant protein corresponding to amino acids 182-229 of human CD79B. |
Immunogen sequence/protein sequence: | DKDDSKAGMEEDHTYEGLDIDQTATYEDIVTLRTGEVKWSVGEHPGQE |
Protein accession: | P40259 |
Form: | Liquid |
Recommend dilutions: | Immunofluorescence (1-4 ug/mL) Immunohistochemistry (1:200-1:500) Western Blot (1:100-1:250) The optimal working dilution should be determined by the end user. |
Storage buffer: | In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide) |
Storage instruction: | Store at 4°C. For long term storage store at -20°C. Aliquot to avoid repeated freezing and thawing. |
Note: | This product contains sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only. |
Product type: | Primary antibodies |
Host species: | Rabbit |
Antigen species / target species: | Human |
Reactivity: | Human |
Application image: | ![]() |
Application image note: | Immunofluorescence staining of U-2 OS cells with CD79B polyclonal antibody (Cat# PAB29311) under 1-4 ug/mL working concentration. |
Applications: | IHC-P,IF,WB-Tr |
Shipping condition: | Dry Ice |