Brand | Abnova |
Product type | Primary antibodies |
Reactivity | Human |
Host species | Rabbit |
Applications | WB,IHC-P,IF |
Brand: | Abnova |
Reference: | PAB29308 |
Product name: | BTK polyclonal antibody |
Product description: | Rabbit polyclonal antibody raised against recombinant human BTK. |
Isotype: | IgG |
Gene id: | 695 |
Gene name: | BTK |
Gene alias: | AGMX1|AT|ATK|BPK|IMD1|MGC126261|MGC126262|PSCTK1|XLA |
Gene description: | Bruton agammaglobulinemia tyrosine kinase |
Immunogen: | Recombinant protein corresponding to amino acids 206-351 of human BTK. |
Immunogen sequence/protein sequence: | PAAAPVSTSELKKVVALYDYMPMNANDLQLRKGDEYFILEESNLPWWRARDKNGQEGYIPSNYVTEAEDSIEMYEWYSKHMTRSQAEQLLKQEGKEGGFIVRDSSKAGKYTVSVFAKSTGDPQGVIRHYVVCSTPQSQYYLAEKHL |
Protein accession: | Q06187 |
Form: | Liquid |
Recommend dilutions: | Immunofluorescence (1-4 ug/mL) Immunohistochemistry (1:200-1:500) Western Blot (1:100-1:250) The optimal working dilution should be determined by the end user. |
Storage buffer: | In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide) |
Storage instruction: | Store at 4°C. For long term storage store at -20°C. Aliquot to avoid repeated freezing and thawing. |
Note: | This product contains sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only. |
Product type: | Primary antibodies |
Host species: | Rabbit |
Antigen species / target species: | Human |
Reactivity: | Human |
Application image: | ![]() |
Application image note: | Immunofluorescence staining of U-251 MG cells with BTK polyclonal antibody (Cat# PAB29308) under 1-4 ug/mL working concentration. |
Applications: | WB,IHC-P,IF |
Shipping condition: | Dry Ice |