WDHD1 polyclonal antibody View larger

WDHD1 polyclonal antibody

New product

455,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of WDHD1 polyclonal antibody

BrandAbnova
Product typePrimary antibodies
ReactivityHuman,Rat
Host speciesRabbit
ApplicationsWB-Ce,IHC-P,IF

More info about WDHD1 polyclonal antibody

Brand: Abnova
Reference: PAB29306
Product name: WDHD1 polyclonal antibody
Product description: Rabbit polyclonal antibody raised against recombinant human WDHD1.
Isotype: IgG
Gene id: 11169
Gene name: WDHD1
Gene alias: AND-1
Gene description: WD repeat and HMG-box DNA binding protein 1
Immunogen: Recombinant protein corresponding to amino acids 231-345 of human WDHD1.
Immunogen sequence/protein sequence: QTLNIVTWSPCGQYLAAGSINGLIIVWNVETKDCMERVKHEKGYAICGLAWHPTCGRISYTDAEGNLGLLENVCDPSGKTSSSKVSSRVEKDYNDLFDGDDMSNAGDFLNDNAVE
Protein accession: C9JW18
Form: Liquid
Recommend dilutions: Immunofluorescence (1-4 ug/mL)
Immunohistochemistry (1:50-1:200)
Western Blot (1:250-1:500)
The optimal working dilution should be determined by the end user.
Storage buffer: In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Storage instruction: Store at 4°C. For long term storage store at -20°C.
Aliquot to avoid repeated freezing and thawing.
Note: This product contains sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
Product type: Primary antibodies
Host species: Rabbit
Antigen species / target species: Human
Reactivity: Human,Rat
Application image: PAB29306-49-224-1.jpg
Application image note: Immunofluorescence staining of U-251 MG cells with WDHD1 polyclonal antibody (Cat# PAB29306) under 1-4 ug/mL working concentration.
Applications: WB-Ce,IHC-P,IF
Shipping condition: Dry Ice

Reviews

Buy WDHD1 polyclonal antibody now

Add to cart