AFF2 polyclonal antibody View larger

AFF2 polyclonal antibody

New product

455,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of AFF2 polyclonal antibody

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesRabbit
ApplicationsIHC

More info about AFF2 polyclonal antibody

Brand: Abnova
Reference: PAB28742
Product name: AFF2 polyclonal antibody
Product description: Rabbit polyclonal antibody raised against recombinant AFF2.
Isotype: IgG
Gene id: 2334
Gene name: AFF2
Gene alias: FMR2|FRAXE|MRX2|OX19
Gene description: AF4/FMR2 family, member 2
Immunogen: Recombinant protein corresponding to amino acids of human AFF2.
Immunogen sequence/protein sequence: SSTSDSNTDQEETLQIKVLPPCIISGGNTAKSKEICGASLTLSTLMSSSGSNNNLSISNEEPTFSPIPVMQTEILSPLRDHENLKNLWVKIDLDLLSRVPGHSSLHAAPAKPDHKETATKPKRQTAVTAVEKPAPKGKRKH
Form: Liquid
Recommend dilutions: Immunohistochemistry (1:20-1:50)
The optimal working dilution should be determined by the end user.
Storage buffer: In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Storage instruction: Store at 4°C. For long term storage store at -20°C.
Aliquot to avoid repeated freezing and thawing.
Note: This product contains sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
Product type: Primary antibodies
Host species: Rabbit
Antigen species / target species: Human
Reactivity: Human
Application image: PAB28742-32-43-1.jpg
Application image note: Immunohistochemical staining of human skeletal muscle with AFF2 polyclonal antibody (Cat # PAB28742) shows strong cytoplasmic positivity in myocytes.
Applications: IHC
Shipping condition: Dry Ice

Reviews

Buy AFF2 polyclonal antibody now

Add to cart