EP300 polyclonal antibody View larger

EP300 polyclonal antibody

New product

455,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of EP300 polyclonal antibody

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesRabbit
ApplicationsIHC,IF

More info about EP300 polyclonal antibody

Brand: Abnova
Reference: PAB28738
Product name: EP300 polyclonal antibody
Product description: Rabbit polyclonal antibody raised against recombinant EP300.
Isotype: IgG
Gene id: 2033
Gene name: EP300
Gene alias: KAT3B|p300
Gene description: E1A binding protein p300
Immunogen: Recombinant protein corresponding to amino acids of human EP300.
Immunogen sequence/protein sequence: FLPQTQFPSQGMNVTNIPLAPSSGQAPVSQAQMSSSSCPVNSPIMPPGSQGSHIHCPQLPQPALHQNSPSPVPSRTPTPHHTPPSIGAQQPPATTIPAPVPTPPAMPPGPQSQALHPPPRQTPTPPTTQLPQQ
Form: Liquid
Recommend dilutions: Immunohistochemistry (1:50-1:200)
Immunofluorescence (1-4 ug/ml)
The optimal working dilution should be determined by the end user.
Storage buffer: In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide).
Storage instruction: Store at 4°C. For long term storage store at -20°C.
Aliquot to avoid repeated freezing and thawing.
Note: This product contains sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
Product type: Primary antibodies
Host species: Rabbit
Antigen species / target species: Human
Reactivity: Human
Application image: PAB28738-32-7-1.jpg
Application image note: Immunohistochemical staining of human colon with EP300 polyclonal antibody (Cat # PAB28738) shows strong nuclear and cytoplasmic positivity in glandular cells.
Applications: IHC,IF
Shipping condition: Dry Ice

Reviews

Buy EP300 polyclonal antibody now

Add to cart