GPHN polyclonal antibody View larger

GPHN polyclonal antibody

New product

455,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of GPHN polyclonal antibody

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesRabbit
ApplicationsWB,IHC

More info about GPHN polyclonal antibody

Brand: Abnova
Reference: PAB28735
Product name: GPHN polyclonal antibody
Product description: Rabbit polyclonal antibody raised against recombinant GPHN.
Isotype: IgG
Gene id: 10243
Gene name: GPHN
Gene alias: GEPH|GPH|GPHRYN|KIAA1385
Gene description: gephyrin
Immunogen: Recombinant protein corresponding to amino acids of human GPHN.
Immunogen sequence/protein sequence: ATIQEHGYPTINLGIVGDNPDDLLNALNEGISRADVIITSGGVSMGEKDYLKQVLDIDLHAQIHFGRVFMKPGLPTTFATLDIDGVRKIIFALPGNPVSAVVTCNLFVVPALRKMQGILDPRPTIIKARLSCDVKLDPRPEY
Form: Liquid
Recommend dilutions: Immunohistochemistry (1:20-1:50)
Western Blot (1:100 - 1:250)
The optimal working dilution should be determined by the end user.
Storage buffer: In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide).
Storage instruction: Store at 4°C. For long term storage store at -20°C.
Aliquot to avoid repeated freezing and thawing.
Note: This product contains sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
Product type: Primary antibodies
Host species: Rabbit
Antigen species / target species: Human
Reactivity: Human
Application image: PAB28735-12-multi-1.jpg
Application image note: Western blot analysis of Lane 1: Human cell line RT-4, Lane 2: Human cell line U-251MG sp, Lane 3: Human plasma (IgG/HSA depleted), Lane 4: Human liver tissue, Lane 5: Human tonsil tissue with GPHN polyclonal antibody (Cat # PAB28735).
Applications: WB,IHC
Shipping condition: Dry Ice

Reviews

Buy GPHN polyclonal antibody now

Add to cart