PLXNB2 polyclonal antibody View larger

PLXNB2 polyclonal antibody

New product

455,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of PLXNB2 polyclonal antibody

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesRabbit
ApplicationsIHC

More info about PLXNB2 polyclonal antibody

Brand: Abnova
Reference: PAB28733
Product name: PLXNB2 polyclonal antibody
Product description: Rabbit polyclonal antibody raised against recombinant PLXNB2.
Isotype: IgG
Gene id: 23654
Gene name: PLXNB2
Gene alias: KIAA0315|MM1|Nbla00445|PLEXB2|dJ402G11.3
Gene description: plexin B2
Immunogen: Recombinant protein corresponding to amino acids of human PLXNB2.
Immunogen sequence/protein sequence: DSPSNKLLYAKEISTYKKMVEDYYKGIRQMVQVSDQDMNTHLAEISRAHTDSLNTLVALHQLYQYTQKYYDEIINALEEDPAAQKMQLAFRLQQIAAALENKVTD
Form: Liquid
Recommend dilutions: Immunohistochemistry (1:20-1:50)
The optimal working dilution should be determined by the end user.
Storage buffer: In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide).
Storage instruction: Store at 4°C. For long term storage store at -20°C.
Aliquot to avoid repeated freezing and thawing.
Note: This product contains sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
Product type: Primary antibodies
Host species: Rabbit
Antigen species / target species: Human
Reactivity: Human
Application image: PAB28733-32-B4-1.jpg
Application image note: Immunohistochemical staining of human skeletal muscle with PLXNB2 polyclonal antibody (Cat # PAB28733) shows distinct cytoplasmic positivity in myocytes at 1:20-1:50 dilution.
Applications: IHC
Shipping condition: Dry Ice

Reviews

Buy PLXNB2 polyclonal antibody now

Add to cart