Brand | Abnova |
Product type | Primary antibodies |
Reactivity | Human,Rat |
Host species | Rabbit |
Applications | IHC |
Brand: | Abnova |
Reference: | PAB28727 |
Product name: | OLIG2 polyclonal antibody |
Product description: | Rabbit polyclonal antibody raised against recombinant OLIG2. |
Isotype: | IgG |
Gene id: | 10215 |
Gene name: | OLIG2 |
Gene alias: | BHLHB1|OLIGO2|PRKCBP2|RACK17|bHLHe19 |
Gene description: | oligodendrocyte lineage transcription factor 2 |
Immunogen: | Recombinant protein corresponding to amino acids of human OLIG2. |
Immunogen sequence/protein sequence: | SPEPDDLFLPARSKGSSGSAFTGGTVSSSTPSDCPPELSAELRGAMGSAGAHPGDKLGGSGFKSSSSSTSSSTSSAAASSTKKDKKQMTEPELQQLRLKINSRERKRMHDLNI |
Form: | Liquid |
Recommend dilutions: | Immunohistochemistry (1:1000-1:2500) The optimal working dilution should be determined by the end user. |
Storage buffer: | In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide) |
Storage instruction: | Store at 4°C. For long term storage store at -20°C. Aliquot to avoid repeated freezing and thawing. |
Note: | This product contains sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only. |
Product type: | Primary antibodies |
Host species: | Rabbit |
Antigen species / target species: | Human |
Reactivity: | Human,Rat |
Applications: | IHC |
Shipping condition: | Dry Ice |