ABLIM3 polyclonal antibody View larger

ABLIM3 polyclonal antibody

New product

455,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of ABLIM3 polyclonal antibody

BrandAbnova
Product typePrimary antibodies
ReactivityHuman,Mouse,Rat
Host speciesRabbit
ApplicationsIHC,WB-Ce

More info about ABLIM3 polyclonal antibody

Brand: Abnova
Reference: PAB28724
Product name: ABLIM3 polyclonal antibody
Product description: Rabbit polyclonal antibody raised against recombinant ABLIM3.
Isotype: IgG
Gene id: 22885
Gene name: ABLIM3
Gene alias: HMFN1661
Gene description: actin binding LIM protein family, member 3
Immunogen: Recombinant protein corresponding to amino acids of human ABLIM3.
Immunogen sequence/protein sequence: DLSTATKSKTSEDISQTSKYSPIYSPDPYYASESEYWTYHGSPKVPRARRFSSGGEEDDFDRSMHKLQSGIGRLILKEEMKARSSSYADPWTPPRSSTSSREALHTAGYEMSLNGSPRSHYLADSDPLISKSASLPAYRRNGLHRT
Form: Liquid
Recommend dilutions: Immunohistochemistry (1:10-1:20)
Western Blot (1:100-1:500)
The optimal working dilution should be determined by the end user.
Storage buffer: In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Storage instruction: Store at 4°C. For long term storage store at -20°C.
Aliquot to avoid repeated freezing and thawing.
Note: This product contains sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
Product type: Primary antibodies
Host species: Rabbit
Antigen species / target species: Human
Reactivity: Human,Mouse,Rat
Application image: PAB28724-32-51-1.jpg
Application image note: Immunohistochemical staining of human cerebral cortex with ABLIM3 polyclonal antibody (Cat # PAB28724) shows strong cytoplasmic positivity in neuronal cells.
Applications: IHC,WB-Ce
Shipping condition: Dry Ice

Reviews

Buy ABLIM3 polyclonal antibody now

Add to cart