SCHIP1 polyclonal antibody View larger

SCHIP1 polyclonal antibody

New product

455,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of SCHIP1 polyclonal antibody

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesRabbit
ApplicationsWB,IHC

More info about SCHIP1 polyclonal antibody

Brand: Abnova
Reference: PAB28723
Product name: SCHIP1 polyclonal antibody
Product description: Rabbit polyclonal antibody raised against recombinant SCHIP1.
Isotype: IgG
Gene id: 29970
Gene name: SCHIP1
Gene alias: FLJ39160|SCHIP-1
Gene description: schwannomin interacting protein 1
Immunogen: Recombinant protein corresponding to amino acids of human SCHIP1.
Immunogen sequence/protein sequence: YSDRDTTEEESESLDDMDFLTRQKKLQAEAKMALAMAKPMAKMQVEVEKQNRKKSPVADLLPHMPHISECLMKRSLKPTDLRDMTIGQLQVIVNDLHSQIESLNEELVQLLLIRDELHTEQDAMLVDIEDLTRHAESQQKHMAEK
Form: Liquid
Recommend dilutions: Immunohistochemistry (1:200-1:500)
Western Blot (1:100-1:250)
The optimal working dilution should be determined by the end user.
Storage buffer: In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Storage instruction: Store at 4°C. For long term storage store at -20°C.
Aliquot to avoid repeated freezing and thawing.
Note: This product contains sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
Product type: Primary antibodies
Host species: Rabbit
Antigen species / target species: Human
Reactivity: Human
Application image: PAB28723-32-4-1.jpg
Application image note: Immunohistochemical staining of human stomach with SCHIP1 polyclonal antibody (Cat # PAB28723) shows cytoplasmic positivity in glandular cells.
Applications: WB,IHC
Shipping condition: Dry Ice

Reviews

Buy SCHIP1 polyclonal antibody now

Add to cart