SLC44A2 polyclonal antibody View larger

SLC44A2 polyclonal antibody

New product

455,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of SLC44A2 polyclonal antibody

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesRabbit
ApplicationsIHC,IF

More info about SLC44A2 polyclonal antibody

Brand: Abnova
Reference: PAB28721
Product name: SLC44A2 polyclonal antibody
Product description: Rabbit polyclonal antibody raised against recombinant SLC44A2.
Isotype: IgG
Gene id: 57153
Gene name: SLC44A2
Gene alias: CTL2|DKFZp666A071|FLJ44586|PP1292
Gene description: solute carrier family 44, member 2
Immunogen: Recombinant protein corresponding to amino acids of human SLC44A2.
Immunogen sequence/protein sequence: NENKPYLFYFNIVKCASPLVLLEFQCPTPQICVEKCPDRYLTYLNARSSRDFEYYKQFCVPGFKNNKGVAEVLRDGDCPAVLIPSKPLARRCFPAIHAYKGVLMVGNETTYEDGHGSRKNITDLVE
Form: Liquid
Recommend dilutions: Immunohistochemistry (1:200-1:500)
Immunofluorescence (1-4 ug/ml)
The optimal working dilution should be determined by the end user.
Storage buffer: In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Storage instruction: Store at 4°C. For long term storage store at -20°C.
Aliquot to avoid repeated freezing and thawing.
Note: This product contains sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
Product type: Primary antibodies
Host species: Rabbit
Antigen species / target species: Human
Reactivity: Human
Application image: PAB28721-32-36-1.jpg
Application image note: Immunohistochemical staining of human small intestine with SLC44A2 polyclonal antibody (Cat # PAB28721) shows membranous positivity in glandular cells.
Applications: IHC,IF
Shipping condition: Dry Ice

Reviews

Buy SLC44A2 polyclonal antibody now

Add to cart