ZNF155 polyclonal antibody View larger

ZNF155 polyclonal antibody

New product

455,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of ZNF155 polyclonal antibody

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesRabbit
ApplicationsIHC,IF,WB-Tr

More info about ZNF155 polyclonal antibody

Brand: Abnova
Reference: PAB28720
Product name: ZNF155 polyclonal antibody
Product description: Rabbit polyclonal antibody raised against recombinant ZNF155.
Isotype: IgG
Gene id: 7711
Gene name: ZNF155
Gene alias: MGC161655|pHZ-96
Gene description: zinc finger protein 155
Immunogen: Recombinant protein corresponding to amino acids of human ZNF155.
Immunogen sequence/protein sequence: TCHFLREEKFWMMGTATQREGNSGGKIQTELESVPEAGAHEEWSCQQIWEQIAKDLTRSQDSIINNSQFFENGDVPSQVEAGLPTIHTGQKPSQGGKCKQSFSDVPIFDLPQ
Form: Liquid
Recommend dilutions: Immunohistochemistry (1:50-1:200)
Immunofluorescence (1-4 ug/ml)
Western Blot (1:100-1:250)
The optimal working dilution should be determined by the end user.
Storage buffer: In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Storage instruction: Store at 4°C. For long term storage store at -20°C.
Aliquot to avoid repeated freezing and thawing.
Note: This product contains sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
Product type: Primary antibodies
Host species: Rabbit
Antigen species / target species: Human
Reactivity: Human
Application image: PAB28720-32-38-1.jpg
Application image note: Immunohistochemical staining of human pancreas with ZNF155 polyclonal antibody (Cat # PAB28720) shows cytoplasmic positivity in exocrine glandular cells at 1:50-1:200 dilution.
Applications: IHC,IF,WB-Tr
Shipping condition: Dry Ice

Reviews

Buy ZNF155 polyclonal antibody now

Add to cart