SAGE1 polyclonal antibody View larger

SAGE1 polyclonal antibody

New product

455,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of SAGE1 polyclonal antibody

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesRabbit
ApplicationsIHC,IF

More info about SAGE1 polyclonal antibody

Brand: Abnova
Reference: PAB28717
Product name: SAGE1 polyclonal antibody
Product description: Rabbit polyclonal antibody raised against recombinant SAGE1.
Isotype: IgG
Gene id: 55511
Gene name: SAGE1
Gene alias: SAGE
Gene description: sarcoma antigen 1
Immunogen: Recombinant protein corresponding to amino acids of human SAGE1.
Immunogen sequence/protein sequence: HSVREEKMESGKPQTDKVISNDAPQLGHMAAGGIPSMSTKDLYATVTQNVHEERMENNQPQPSYDLSTVLPGLTYLTVAGIPAMSTRDQYATVTHNVHEEKIKNGQAASDNVFSTVPPAFINMAATGVSSMSTRDQYAAVTHNIR
Form: Liquid
Recommend dilutions: Immunohistochemistry (1:200-1:500)
Immunofluorescence (1-4 ug/ml)
The optimal working dilution should be determined by the end user.
Storage buffer: In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Storage instruction: Store at 4°C. For long term storage store at -20°C.
Aliquot to avoid repeated freezing and thawing.
Note: This product contains sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
Product type: Primary antibodies
Host species: Rabbit
Antigen species / target species: Human
Reactivity: Human
Application image: PAB28717-32-12-1.jpg
Application image note: Immunohistochemical staining of human testis with SAGE1 polyclonal antibody (Cat # PAB28717) show strong nuclear positivity in a fraction of cells of seminiferous duct.
Applications: IHC,IF
Shipping condition: Dry Ice

Reviews

Buy SAGE1 polyclonal antibody now

Add to cart