ZNF764 polyclonal antibody View larger

ZNF764 polyclonal antibody

New product

455,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of ZNF764 polyclonal antibody

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesRabbit
ApplicationsIHC,WB-Ce

More info about ZNF764 polyclonal antibody

Brand: Abnova
Reference: PAB28715
Product name: ZNF764 polyclonal antibody
Product description: Rabbit polyclonal antibody raised against recombinant ZNF764.
Isotype: IgG
Gene id: 92595
Gene name: ZNF764
Gene alias: MGC13138
Gene description: zinc finger protein 764
Immunogen: Recombinant protein corresponding to amino acids of human ZNF764.
Immunogen sequence/protein sequence: VYFCREEWGCLRPAQRALYRDVMRETYGHLSALGIGGNKPALISWVEEEAELWGPAAQDPEVAKCQTQTDPDSRNKKKERQREGTGALEKPDPVAAGSPGLKSPQAPSAGPPYGWEQLSKAPHRGRPSLCAHPPVPRADQRH
Form: Liquid
Recommend dilutions: Immunohistochemistry (1:50-1:200)
Western Blot (1:100-1:250)
The optimal working dilution should be determined by the end user.
Storage buffer: In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Storage instruction: Store at 4°C. For long term storage store at -20°C.
Aliquot to avoid repeated freezing and thawing.
Note: This product contains sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
Product type: Primary antibodies
Host species: Rabbit
Antigen species / target species: Human
Reactivity: Human
Application image: PAB28715-32-35-1.jpg
Application image note: Immunohistochemical staining of human esophagus with ZNF764 polyclonal antibody (Cat # PAB28715) show strong cytoplasmic and nuclear positivity in squamous epithelial cells.
Applications: IHC,WB-Ce
Shipping condition: Dry Ice

Reviews

Buy ZNF764 polyclonal antibody now

Add to cart