CILP polyclonal antibody View larger

CILP polyclonal antibody

New product

455,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of CILP polyclonal antibody

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesRabbit
ApplicationsIHC

More info about CILP polyclonal antibody

Brand: Abnova
Reference: PAB28713
Product name: CILP polyclonal antibody
Product description: Rabbit polyclonal antibody raised against recombinant CILP.
Isotype: IgG
Gene id: 8483
Gene name: CILP
Gene alias: CILP-1|HsT18872
Gene description: cartilage intermediate layer protein, nucleotide pyrophosphohydrolase
Immunogen: Recombinant protein corresponding to amino acids of human CILP.
Immunogen sequence/protein sequence: YKHESKLVLRKLQQHQAGEYFCKAQSDAGAVKSKVAQLIVTASDETPCNPVPESYLIRLPHDCFQNATNSFYYDVGRCPVKTCAGQQDNGIRCRDAVQNCCGISKTEEREIQCSGYTLPTK
Form: Liquid
Recommend dilutions: Immunohistochemistry (1:200-1:500)
The optimal working dilution should be determined by the end user.
Storage buffer: In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Storage instruction: Store at 4°C. For long term storage store at -20°C.
Aliquot to avoid repeated freezing and thawing.
Note: This product contains sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
Product type: Primary antibodies
Host species: Rabbit
Antigen species / target species: Human
Reactivity: Human
Application image: PAB28713-32-40-1.jpg
Application image note: Immunohistochemical staining of human ovary with CILP polyclonal antibody (Cat # PAB28713) show strong cytoplasmic positivity in follicle cells at 1:200-1:500 dilution.
Applications: IHC
Shipping condition: Dry Ice

Reviews

Buy CILP polyclonal antibody now

Add to cart