MED12 polyclonal antibody View larger

MED12 polyclonal antibody

New product

455,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of MED12 polyclonal antibody

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesRabbit
ApplicationsIHC,IF

More info about MED12 polyclonal antibody

Brand: Abnova
Reference: PAB28710
Product name: MED12 polyclonal antibody
Product description: Rabbit polyclonal antibody raised against recombinant MED12.
Isotype: IgG
Gene id: 9968
Gene name: MED12
Gene alias: CAGH45|FGS1|HOPA|KIAA0192|OKS|OPA1|TNRC11|TRAP230
Gene description: mediator complex subunit 12
Immunogen: Recombinant protein corresponding to amino acids of human MED12.
Immunogen sequence/protein sequence: RLLLYHTHLRPRPRAYYLEPLPLPPEDEEPPAPTLLEPEKKAPEPPKTDKPGAAPPSTEERKKKSTKGKKRSQPATKTEDYGMGPGRSGPYGVTVPPDLLHHPNPGSITHLNYRQGSIGLYTQNQ
Form: Liquid
Recommend dilutions: Immunohistochemistry (1:20-1:50)
Immunofluorescence (1-4 ug/ml)
The optimal working dilution should be determined by the end user.
Storage buffer: In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Storage instruction: Store at 4°C. For long term storage store at -20°C.
Aliquot to avoid repeated freezing and thawing.
Note: This product contains sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
Product type: Primary antibodies
Host species: Rabbit
Antigen species / target species: Human
Reactivity: Human
Application image: PAB28710-32-70-1.jpg
Application image note: Immunohistochemical staining of human bone marrow with MED12 polyclonal antibody (Cat # PAB28710) show strong nuclear positivity in hematopoietic cells.
Applications: IHC,IF
Shipping condition: Dry Ice

Reviews

Buy MED12 polyclonal antibody now

Add to cart