NLGN3 polyclonal antibody View larger

NLGN3 polyclonal antibody

New product

455,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of NLGN3 polyclonal antibody

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesRabbit
ApplicationsIHC,WB-Tr

More info about NLGN3 polyclonal antibody

Brand: Abnova
Reference: PAB28709
Product name: NLGN3 polyclonal antibody
Product description: Rabbit polyclonal antibody raised against recombinant NLGN3.
Isotype: IgG
Gene id: 54413
Gene name: NLGN3
Gene alias: ASPGX1|AUTSX1|HNL3|KIAA1480
Gene description: neuroligin 3
Immunogen: Recombinant protein corresponding to amino acids of human NLGN3.
Immunogen sequence/protein sequence: APAPTVNTHFGKLRGARVPLPSEILGPVDQYLGVPYAAPPIGEKRFLPPEPPPSWSGIRNATHFPPVCPQNIHTAVPEVMLPVWFTANLDIVATYIQEPNEDCLYLNVYVPTED
Form: Liquid
Recommend dilutions: Immunohistochemistry (1:50-1:200)
Western Blot (1:100-1:250)
The optimal working dilution should be determined by the end user.
Storage buffer: In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Storage instruction: Store at 4°C. For long term storage store at -20°C.
Aliquot to avoid repeated freezing and thawing.
Note: This product contains sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
Product type: Primary antibodies
Host species: Rabbit
Antigen species / target species: Human
Reactivity: Human
Application image: PAB28709-32-52-1.jpg
Application image note: Immunohistochemical staining of human cerebellum with NLGN3 polyclonal antibody (Cat # PAB28709) show scytoplasmic positivity in purkinje cells and in cells of granular layer.
Applications: IHC,WB-Tr
Shipping condition: Dry Ice

Reviews

Buy NLGN3 polyclonal antibody now

Add to cart